PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa00532s330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 204aa    MW: 23180.9 Da    PI: 4.9677
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa00532s330.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.94e-195511056
                    HHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox 10 eqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                     q++ Le+ Fe ++++  e++++LAkklgL+ rqV vWFqNrRa++k
  Csa00532s330.1  5 FQVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWK 51
                    5999******************************************9 PP

2HD-ZIP_I/II123.41.1e-396891093
     HD-ZIP_I/II 10 qvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93
                    qv+lLE+sFe+e+kLeperK++la++LglqprqvavWFqnrRAR+ktkqlE+dy+ Lk++yd+l ++ +++ k++++Lr+e+++
  Csa00532s330.1  6 QVHLLEKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKSTYDQLLSNYDSIVKDNDKLRSEVTS 89
                    9******************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.39153IPR001356Homeobox domain
SMARTSM003891.6E-12157IPR001356Homeobox domain
SuperFamilySSF466897.7E-18563IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.2E-21560IPR009057Homeodomain-like
PfamPF000463.9E-16651IPR001356Homeobox domain
CDDcd000861.61E-16654No hitNo description
PRINTSPR000312.5E-62433IPR000047Helix-turn-helix motif
PROSITE patternPS0002702851IPR017970Homeobox, conserved site
PRINTSPR000312.5E-63349IPR000047Helix-turn-helix motif
PfamPF021834.6E-175394IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MMHVFQVHLL EKSFETENKL EPERKTQLAK KLGLQPRQVA VWFQNRRARW KTKQLERDYD  60
LLKSTYDQLL SNYDSIVKDN DKLRSEVTSL TEKLLGKDEE ANELPPGRQV PEPNQLDPVY  120
LNPAAIKTED RLSSGSVGSA VLDEDAPQLL DSCDSYFPSL VPIHSQQDNI ACDNDRACFS  180
DVFVPTTSPS HHHSESLGFW GWP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14553RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0581881e-176AY058188.1 Arabidopsis thaliana AT3g01470/F4P13_2 mRNA, complete cds.
GenBankAY0989721e-176AY098972.1 Arabidopsis thaliana AT3g01470/F4P13_2 mRNA, complete cds.
GenBankX588211e-176X58821.1 A.thaliana homeobox gene Athb-1 mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010496310.11e-146PREDICTED: homeobox-leucine zipper protein HAT5-like
SwissprotQ022831e-123HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLR0HRX81e-123R0HRX8_9BRAS; Uncharacterized protein
STRINGAT3G01470.11e-121(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88842738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-115homeobox 1